SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016035 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016035
Domain Number 1 Region: 186-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 223-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000131
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 318-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000762
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 89-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 5-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000364
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000016035
Domain Number - Region: 44-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00178
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016035   Gene: ENSPVAG00000016998   Transcript: ENSPVAT00000016998
Sequence length 535
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3266:6062:20276:-1 gene:ENSPVAG00000016998 transcript:ENSPVAT00000016998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYESHTRVHTGEKPFECDVCHQRYSTKSNLTVHRKKHSADTEVPKKEHRCPRCDKLHASK
KTLAKHIKRFHPENAQEFISIKKTKSESWKCDICKKSFTRRPHLEEHMILHSQDKPFKCT
YCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECTHGGKRKWTCFICGK
SVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDKRYECDECGKTFIR
HDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYRSVHLGEKVWQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEKPYKCQICNQSFRIKKTLTKHLVIHSDARPFNCQHCNATFK
RKDKLKYHTDHVHGIKSPDDPLSTSEEKLVALPVEYSSDDKLFQADTKQYLDRPKAYPSG
AKTMLQNVSAEVCVPVTLVPVQMPDSQSDLVRHTTTLPPPSHEILSPQPPSAEYPRAADL
AFLEKYTLTPQPANIVHPVRPEQMLDPGEQSYLGTLLGLDDAAAVPSASGDEHRS
Download sequence
Identical sequences ENSPVAP00000016035 ENSPVAP00000016035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]