SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000284 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000284
Domain Number 1 Region: 543-648
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-26
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 427-545
Classification Level Classification E-value
Superfamily Second domain of FERM 5.23e-23
Family Second domain of FERM 0.00055
Further Details:      
 
Domain Number 3 Region: 1056-1165
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-21
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 768-854
Classification Level Classification E-value
Superfamily PDZ domain-like 1.3e-17
Family PDZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 343-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000145
Family First domain of FERM 0.038
Further Details:      
 
Domain Number 6 Region: 918-988
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000329
Family PDZ domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000284
Domain Number - Region: 76-162
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.053
Family Protein kinases, catalytic subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000284   Gene: ENSPVAG00000000308   Transcript: ENSPVAT00000000308
Sequence length 1302
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2986:8817:115516:-1 gene:ENSPVAG00000000308 transcript:ENSPVAT00000000308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLTQDTGMNPASVTLASALRVKGEALSEEEIWSLLSLAAEHLLEDLRKGSSDYVVCPC
STLLSASGSLSFQSHISHIEAALFKAPELLQQQNDDEQLDASQAHVYSLGTTLYWSAGFH
VPPNQSLQLLEPLHSVLLTMCEDQPHRRLPLQSVLEACQVHREVAVYPASANLHIKRLVG
LVLGTISEVERRVMDESSSVQQDRSYFLRNRLHQACCESPVARALERLHPCGVSERSTET
QSSLEPGPSTSALGHCNFSVNSALPAEAPQDLQEGRQPSSGSTLSMAVQNSQPTTPSQKH
FLQRKGKFSRPEFILLAGEAPVTLHLPGSIVTKKGKSCLTLRDLCVILLSGQCLEVKCDI
TSTVGAVFNAVMSFTNLGELTYFGLAYLKGKEFFFLDNQIRLCKIAPEGWSEQPQKTSSR
AFTLFLRIKFYVSHYGLLQQSWTRHQFYLQLRKDILEEKMYCNDEMLLQLGVLALQAEFG
SYPEEQVERKAYFRVEDYIPASLIERMTALRVQVQVSEMHRLSPVLCEEDAELEFLRVTQ
QLPEYGVLVYQVLPEKTRPEGEMALGICAKGVIIYEVKNNSRIATLRFQWREIGKISTYR
KKFTITSSITGKKHTFVTDSAKTCKYLLGLCSAQHSFNAQMNAPRVASDYNKCVQMVNMS
RSYLAQSKPLTWIQRLSCSENVLFTPRQKDTVGGLLCTSLDNFTMDTSRETGALAVSGSP
STGQEQLENICLIQKPMTCGPFSGQSIQSMCAXXXXXXXXXXXAELDREIVHVTLRDHRV
CFVINEGEDVGKVDPGIFISSIIPGGPAEKAKKIKPGGQILALNHISLEGFTFDMAVRMI
QNSPDNIELIISQSKGICGNTSREGKNSMASSGVFSTDNLSNRHQGSFLSYTQDQERNIE
ELEMTRTQSLLSRLRPQLSILPLKGTGSSCLPSSSEANAGGIYFVELAKEDGTFGFSITG
GVNTSVLYGGIYIKSIVPGGPAAKEGQILQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
ARLVLERRGPRTAQQCPVNNRMGDECMAVSLATALPGRPASCVSVTDGPKFEVKLKKNAS
GLGFSFVQMERKSCSRLKNDLVRIKRLFPGQPAEENGAIAAGDIILAVNGRSTEGLVFQE
VLHLLRGASQEVTLLLCRPPPGVLPEMDQGWQTPELLADKEFTRATCTDSEQSPSLDQED
SWRDSVSPDAGDGLGLKPESFQQATREAQWDHDIERPWATSLMRPGDSHPHLCRLYQEVD
SGASATCLEKDVRQNCYSVCDIRRLERFSYSSSLTSLSTDIF
Download sequence
Identical sequences ENSPVAP00000000284 ENSPVAP00000000284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]