SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000470 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000470
Domain Number 1 Region: 449-560
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-19
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 743-808
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 802-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000981
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 5 Region: 870-929
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000131
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 390-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000118
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 564-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000432
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 673-736
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000811
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000470   Gene: ENSPVAG00000000501   Transcript: ENSPVAT00000000501
Sequence length 1022
Comment pep:novel genescaffold:pteVam1:GeneScaffold_582:75943:235474:1 gene:ENSPVAG00000000501 transcript:ENSPVAT00000000501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAARPPAAGLGGISLLLALLLGILAAALEGDAPPEGDANPSGTYLLPSGALRSTSLSKD
SLEERATTAPLSPVQSGEELRELEQEGTVPSAHPEPSSLSTLLPEEASPQLAFLPRKKLP
SLKQVNSARKQLRPKATSAAAPPRAESQPASPGGLSSATEKSPPGDLPDSEETLRLPSEE
PLWLNRKEGAVPTTRAPMQISFTSQPYVAHTLPESPDPGEPAMSDETHEAPPEDASPMNL
MDKGENDLTGSASEESQETTTSTIITTTVITTEQAPALCSVSLSDPEGYIDSSDYPPLPI
NSFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPTLTVLANQTLLVEGQVIRS
PTNTISVYFRTFQDDGLGTFQLHYQAFMLSCTFPRRPEYGDVTVMDLHSGGVAHFHCHLG
YELQGAKTLTCINASKPHWSSQEPVCSAPCGGAVHNATIGRVLSPSYPGNSNESQFCVWT
IEAPEGQKLHLHFERLLLHEKDRMMVYSGLTNKSTLLHDSLPTESVPFEGLLSEGNSIRI
EFTSNQARAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSLEQ
GPAIIECINVRDPYWNDTEPLCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPA
GLIFGKGQGFIINYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGS
DTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEG
SSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCY
EGFELMGEVTIRCILGQPSHWNGPLPICKVNQDSFEHALEVAEAAAETSLEGGNMALAIF
LPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEV
SI
Download sequence
Identical sequences ENSPVAP00000000470 ENSPVAP00000000470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]