SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001284 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001284
Domain Number 1 Region: 584-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-67
Family SPRY domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 9.06e-22
Family Pyrin domain, PYD 0.0037
Further Details:      
 
Domain Number 3 Region: 358-421
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001284   Gene: ENSPVAG00000001366   Transcript: ENSPVAT00000001366
Sequence length 771
Comment pep:novel genescaffold:pteVam1:GeneScaffold_66:46330:61280:-1 gene:ENSPVAG00000001366 transcript:ENSPVAT00000001366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPRDHLLFSLEELVPYDLEKFKFKLQNISLEKVPPRIPRGQLQTAKPVKLATLLLDH
YGEKCAVHLTLQVLKAINQHLLAEELHKAIGPEYPNQESGTSCAEVSCFSGENNFKNLRI
PDDPEGDRQRQSGDGAMSLPASQPEAGRGTQKKPQGKRRDQKSSEGPDMQGKPGARGAIL
SFRRSALPSKLQAEKGNNVSVRLRRNASSAGRLQGLVGGSLGRKECKLSEAHLPSKRRPK
SLEFTISSGEREPLNPSILFPQEKMRSETLDLTATPSEVATLDVGAAVAPERGSRNSEHW
RSVCTLCCTQGDLVGGTCTHDSCSCSIASRDPKVPGVHSPSCPRYQASLTGKHSGSLSPK
PLPQCERHMKQFQLLFCEDHGEPICLICSLSQEHRGHQVRPIEEAALEYKAQIQKQLEHL
KELKKYGEEQRLQGDKDTANYLKLTETPKQKVQYQLEQLYQFLKQQEQLFVAWLEDLGQT
IGQVWETYDNQVSRDIALLDELIEELEAKQCQSEWELMQDIGVTLYRAKMVTTPKPWTTL
PEVKEKVHLLYQKLEFMEKSMKHFSENLHSEMETFSVPKLIGAQAHAVNVLLDVETAHPN
LIFSDDLKSVRLGNKWNCLPDSPERFDSCIITLGSPSFFSGCHYWEVKVGDKTEWILGIC
KTSINRKGSITLSPENGYWVVMMMKRNEYQASTIPPTRLRMKEPPRCVGIFLDYKAGEIS
FYNVTAKSHIYTFTSFSFSGPLQPIFSPGTHNGGKNTEPLTICPVGCQAPH
Download sequence
Identical sequences ENSPVAP00000001284 ENSPVAP00000001284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]