SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002352 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002352
Domain Number 1 Region: 412-736
Classification Level Classification E-value
Superfamily DNase I-like 1.31e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 26-124
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-26
Family SH2 domain 0.00017
Further Details:      
 
Domain Number 3 Region: 1181-1243
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000337
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002352   Gene: ENSPVAG00000002483   Transcript: ENSPVAT00000002489
Sequence length 1245
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2765:17044:30528:1 gene:ENSPVAG00000002483 transcript:ENSPVAT00000002489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASACGTPALGGAGPGGALGSPAPVWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGA
FALCVLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLL
PVERERDPDPPDDRDASDGEDEKPPLPPRSGSTSISVSVGPSNTPPALETPTTPAAESAP
NGLSTVSHEYLKGSYGLDLEAVRSGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKV
FDQQSSPMVTRLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTGPP
ALLQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQE
DWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNK
HSKQDEPDMISIFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQEN
SVGDREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGI
ANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFD
ISLRFTHLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEE
ISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIV
TSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCL
EEYKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESY
GECVVALKSMIGSTAQQFLTFLSHRGEEMXXXRGWISIDKDEAGAKSKAPSVSRGSQEPR
SGSRKPASAEASCPLSKLFEEPEKPPPTGRPPAPPRVAPREEPLTPRLKPEGSPEADGVA
APPPKNSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPPATKNKVAITVPAPQLGRHRPPR
VGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPAVRGRSGGEARGPPPPKA
HPRPPLPPGPSPTSAFLGEVASGDDRSCSVLQMAKTLSEVDYAPAGPGHSVLLPGPLELQ
PPRGLPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQSGRAGGLGEAGMGAWLRAIGLERY
EEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Download sequence
Identical sequences ENSPVAP00000002352 ENSPVAP00000002352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]