SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003221 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003221
Domain Number 1 Region: 110-186
Classification Level Classification E-value
Superfamily WWE domain 4.45e-23
Family WWE domain 0.00093
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily WWE domain 9.68e-23
Family WWE domain 0.0014
Further Details:      
 
Domain Number 3 Region: 393-493
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-17
Family RING finger domain, C3HC4 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003221   Gene: ENSPVAG00000003407   Transcript: ENSPVAT00000003407
Sequence length 621
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1373:311886:334832:1 gene:ENSPVAG00000003407 transcript:ENSPVAT00000003407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAMAPSPSLAQAYTSPVAVAVWEWQDGPGIWHPYSATVCSFIEQQFLSQQKGQPPLGLGE
TLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGIVWEWLSD
DGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYATYTQTNKTSSFCRSVRRQAG
PPYPVTTIIAPPGHTGVACSCHQCLSGGGTGPVSGRYRHSMTSLPAYPVPQPPHRTAIVF
GAHQAFAPYNKPSLSGARSAPRLNTTNPWGGAPPSLGNQSPYCSSLSHLGPPHQPPGSST
TSGASASLPSGPVSSPGSIPATVPVQMPKPSRVQQALAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGTPKPEPEQVIRNYTEELKTAPDEDCIICMEKLS
VVSGYSDVTDSKTIGPVAVGCLSKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT
GTQPRGKMEVFRFQVSLPGHEDCGTILIVYNIPHGIQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPN
YLQNVLAELAAQGVTEDCLEQ
Download sequence
Identical sequences ENSPVAP00000003221 ENSPVAP00000003221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]