SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004003 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004003
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-44
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 201-243
Classification Level Classification E-value
Superfamily SOCS box-like 0.000034
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004003   Gene: ENSPVAG00000004228   Transcript: ENSPVAT00000004227
Sequence length 245
Comment pep:novel genescaffold:pteVam1:GeneScaffold_410:111123:113660:-1 gene:ENSPVAG00000004228 transcript:ENSPVAT00000004227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADVNCTHGTLKPLHCACMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEV
LLEYGANPNALDGNRDTPLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGN
LESVSILLDYGAEVRVINLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKN
GTMPREVARDQQLCEKLTILCSAPGTLKTLSRYAVRRSLGLQYLPDAVKGLPLPASLKEY
LLLVE
Download sequence
Identical sequences ENSPVAP00000004003 ENSPVAP00000004003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]