SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004426 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004426
Domain Number 1 Region: 230-265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 112-224
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000279
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004426   Gene: ENSPVAG00000004676   Transcript: ENSPVAT00000004674
Sequence length 331
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3636:5850:13568:1 gene:ENSPVAG00000004676 transcript:ENSPVAT00000004674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSGTGSRKITVETCFPLLLGSCRLPSLGQAPHPSLPKPKLKILQIFPVVGHSRAWMEPC
LLQLLQRLLLLGAAALTVSALETADLVDLCGQMWQGDGLLMRSHSASRRFYFVDPDTDCE
LWVRAAAHSDRIRFQFRFFLVYTLTSESPASPAPNASSPASADACAPGSYLQFYEGPPGA
PRPLGAPLCGLTIPVPVMSSGEFLGLRLVTRGRQPRVDFLGEVTSFRLGSCDGYFRCWNS
RCIPPSLVCDLWGMDNCGDGSDQASWPPANCRGLSLVPSQVGSTEDDPSKPPTVSSALES
AGPLQIVSESSSPAGQGPIGQDAALEGSSQS
Download sequence
Identical sequences ENSPVAP00000004426 ENSPVAP00000004426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]