SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004905 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004905
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000439
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004905   Gene: ENSPVAG00000005182   Transcript: ENSPVAT00000005181
Sequence length 447
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2077:164444:168796:-1 gene:ENSPVAG00000005182 transcript:ENSPVAT00000005181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADHVSQEPQALLESALPSSKVPAFSDKGGLGDEMLAAALLKAKSQELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTGHDQDISEETGSHGMLLGRFQKD
ISQDLKFEEAYEQEVSLKRQLGNSSGERLNRKIQDFDQVTVEEKLTPMRERSEKYDDFGN
SFTVSSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVTGMNKSSLRVTAELNIREST
Download sequence
Identical sequences ENSPVAP00000004905 ENSPVAP00000004905 XP_011384622.1.92234 XP_011384623.1.92234 XP_011384624.1.92234 XP_011384625.1.92234 XP_011384626.1.92234 XP_011384627.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]