SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005533 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005533
Domain Number 1 Region: 15-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.24e-75
Family Eukaryotic proteases 0.0000000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005533   Gene: ENSPVAG00000005849   Transcript: ENSPVAT00000005849
Sequence length 255
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3718:15976:17713:1 gene:ENSPVAG00000005849 transcript:ENSPVAT00000005849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLSRRLAALMLLGVALCAAQPRGRILGGREAASHQRPYMASVQVNGKHVCGGFLLAEQW
VLSAAHCLEDVTDGKVQVLLGAHSLSQPESSKRLYDVLRAVPHPDSRRDTIDHDLLLLQL
SEKATLGPMVKTLPWQREDRDVPAGTLCDVAGWGVVSHTGRQPDRLQYLTLPVLDRATCN
LRRYHDGTVTERMMCAESSHRRDSCKGDSGGPLVCGGIAVGIVTSGSRVCGNPKKPGIYT
RVASYAAWIDGVMAA
Download sequence
Identical sequences ENSPVAP00000005533 ENSPVAP00000005533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]