SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005884 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005884
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.33e-59
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 234-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000116
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005884   Gene: ENSPVAG00000006224   Transcript: ENSPVAT00000006224
Sequence length 278
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3715:59274:80541:-1 gene:ENSPVAG00000006224 transcript:ENSPVAT00000006224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGTADGRFLGDVGFWVERTAVHEAAQQGEALRLQQLIESGACVNQVTVDSITPLHAAS
LQGQAQCVQLLLAAGAQVEARNIDGSTPLCDACASGSIECVKLLLSHGAKVNPPLYTASP
LHEACMSGNSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLKAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEHYEKTPL
TLSQLCRVSLRKATGVRGLEKIARLDIPSRLIDYLSYN
Download sequence
Identical sequences ENSPVAP00000005884 ENSPVAP00000005884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]