SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006618 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006618
Domain Number 1 Region: 55-186
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.4e-28
Family Hormone receptor domain 0.00082
Further Details:      
 
Domain Number 2 Region: 150-458
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000348
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006618   Gene: ENSPVAG00000007013   Transcript: ENSPVAT00000007013
Sequence length 553
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2827:185926:239562:1 gene:ENSPVAG00000007013 transcript:ENSPVAT00000007013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLEPSRAGPGRRNVGLLPGVQALPTLIPAAWEASPSPSRSKCSLPSPARPFLALLLLVS
IKQVTGSLLEETTRKWAQYKEKCLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNISVPCPS
YLPWWREENSGRAYRHCLAQGTWQTLKNSTDIWQDDSECSENHSFKENVENHALLSTLQL
LYTVGYSLSIVSLLLALTLLLCLRKLHCTRNYIHMNLFASFILRALVVLVKDVILHNSYS
KRPNNEKEWMSYVSEISASCRSAQVLLHYFVGANYSWLLVEGLYLYTLLEPTVISERWLW
PRYLLVGWAFPLLFVVPWSIARAQLENTGCWGINGNMKIWWIIRGPMLLCVAVNFFIFLK
ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVQGFSKLIRLFI
QLTLSSFHGLLVALQYCFANGEVKAELRKHWVRFLLARHSGCRAWVLEKNFRFLGKCPKR
LSKRDSARMLQKPQPSPGSGQLLQLTVQGPGQPGARPHQGHTAWPWVSSLSESSEGDITL
AHTMEESLEESEI
Download sequence
Identical sequences ENSPVAP00000006618 ENSPVAP00000006618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]