SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007940 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007940
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.12e-54
Family Eukaryotic proteases 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007940   Gene: ENSPVAG00000008407   Transcript: ENSPVAT00000008407
Sequence length 253
Comment pep:novel genescaffold:pteVam1:GeneScaffold_570:59118:63112:-1 gene:ENSPVAG00000008407 transcript:ENSPVAT00000008407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRGARIIGGREATPHSRPYMASVSFEGQHHCGGFLLRTRWVVSAAHCFNDRDPRMGLVV
LGAHALHTPEPTQQVFGISAVIRHPNYQPTTHANDICLLQLNSSAALGPAVGLLGLPRRN
ARPLRPGTRCQVAGWGSVSNFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVTCIWDVVRQASS
PGPRTPRPPAGAA
Download sequence
Identical sequences ENSPVAP00000007940 ENSPVAP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]