SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008230 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008230
Domain Number 1 Region: 1209-1313,1367-1502
Classification Level Classification E-value
Superfamily Cullin homology domain 3.4e-37
Family Cullin homology domain 0.0017
Further Details:      
 
Domain Number 2 Region: 808-964
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-36
Family APC10-like 0.0064
Further Details:      
 
Domain Number 3 Region: 363-437
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.41e-31
Family CPH domain 0.00000773
Further Details:      
 
Domain Number 4 Region: 656-756
Classification Level Classification E-value
Superfamily ARM repeat 0.0000733
Family Armadillo repeat 0.056
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000008230
Domain Number - Region: 1551-1640
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0816
Family Penicillinase repressor 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008230   Gene: ENSPVAG00000008717   Transcript: ENSPVAT00000008720
Sequence length 1692
Comment pep:novel genescaffold:pteVam1:GeneScaffold_969:171168:184374:-1 gene:ENSPVAG00000008717 transcript:ENSPVAT00000008720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGEDGEGSSSQVDC
QAEHILLWMSNDEIYANCHKMLGEDGQVYPGPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXDQLNDSAAELGAQNSSAPEESSGERGRLELEF
SMAVGTISELVQTMRWDWASSRQRPSARSSCSIFQPQLAEAGPGLPPTQARPSLRRSRRF
RPRPEFASGNTYALYVRDTLQPGMRVRMLDDFEEISAGDEGEFRQSNSGVPPVQVLWEST
GRTYWVHWHMLEILGFEEDTEDVVEADEYQGAVVSGAQGIALPSWRWKPMTELYAVPYVL
PEDEDTEESEHLTQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPM
ELAQDLLLALPQRLDDSALRDLRNCRVYRKYGPQALAGQLAYPSLPEAQAQPQESAGASR
VEAKEPLIQCPNTPLHRLVEGCGPAGKIILDLEQALSSEGTQENEVKPLLLLLQRQPQPF
LTLMRSLDTPVANKALHLAALRILMRLVDFPEALLLPWHEAMDACMACLQSPDTDREVLQ
ELIFFLYHLASVSRDYAVVLNQLGARDAISRALEKHLGELELAQELRDMVFKCEKHAHLY
RKLTTNILGGCIQMVLGQIEDHRRTHQPINIPFFDVFLRYLCQGSSVEVKEDKCWEKVEV
SSNPHRASKLTDRNPKTYWESNGSTGSHYITLHMHQGVLIRQLTLLVAGEDSSYMPARVV
VFGGDSTSSLNTELNSVNVMPSASRVILLENLNRFWPVIQIRIKRCQQGGIDTRIRGLEV
LGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFAD
HFLPDNEAAQALGKTCWEALVSPLVQNITSPDEDGISPLGWLLDQYLECREAAHNPQSRA
AAFSSRVRRLTHLLVHVEPCEAPPAVGTTPRPKGRNRSHDWSSLATRGLPSSIMRNLTRC
WQSAVEEQVNSFLTSHWRDDDFVPRYCEHFNNLQKSSSELFGPRAAFLLALQNGCAGALL
KLPFLKAAHVSEQFARHIDQRIQGSRIGGARGMEMLAQLQRCLETVLIFSGLEIATTFEH
YYQHYMADRLLSLGSSWLEGAVLEQIGPCFPNRLPQQMLRSLSTSEELQRQFHVYQLQRL
DQELLKLEDTEKKIQVGHEANGKEHEREKEEEGEETGAAADVMEEEEEEENEDLYYEGAM
PEVSVLVLSPRCWPTASICHMLNPRTCLPYYLRGTLNRYSNFYNKSQSYPALEQGPHQLL
QWTWLGRAELQFGDQTLHVSTVQMWLLLYLNDLKVVSVEGLLALSGLSPDMLNQAIGPLT
SSRGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRNLEKRRNL
LNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCIL
HLLGKGTVRRHDDRPQMLSYAVPVTVMEPHTESLNPSSSGPNPPLTFHTLQIRSRGVPYA
SCTSTQSFSTFR
Download sequence
Identical sequences ENSPVAP00000008230 ENSPVAP00000008230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]