SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008262 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008262
Domain Number 1 Region: 499-704
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.44e-48
Family Eukaryotic proteases 0.0000695
Further Details:      
 
Domain Number 2 Region: 189-272
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 280-363
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-30
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 98-189
Classification Level Classification E-value
Superfamily Kringle-like 2.03e-29
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 5 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.16e-17
Family Hairpin loop containing domain 0.012
Further Details:      
 
Domain Number 6 Region: 364-399
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000188
Family Kringle modules 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008262   Gene: ENSPVAG00000008752   Transcript: ENSPVAT00000008753
Sequence length 706
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1015:624732:629539:-1 gene:ENSPVAG00000008752 transcript:ENSPVAT00000008753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTQCSGSPGQRSPLNDFQVLRGTELQHLLHARRPEPWQEDVADAEECAGRC
KPLLDCRAFHYNVSSHGCQLLPWTQNSPHTQLQRSGRCDLFQKKDYVRTCIVDNGVEYRG
TVAITTGGLHCQRWSHRFPNDHRYLPTLRNGENNFCRNPDGDAGGPWCYTTDPAVRFQSC
GIKSCREATCFWCNGEDYRGAVDRTESGRECQRWDLQRPHPHPFEPGKFLDKHLDDNYCR
NPDGSERPWCYTTDPQVEREFCDLPRCGSEVQPSREATTLNCFRGKGEGYRGTANTTTAG
VPCQRWDAQTPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRVAFCYQIRRC
TDDVRPKECYHGAGEKYRGSISKTRKGIPCQRWSAETHSLXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRQGQHFCGSLVKEQWVLTAQQCFSSCHMSLLGYEVWLGTMFQN
PQPGEPGLQRVSVAKMVCGPSGSQLALLKLERPVTLNQYVALICLPPERYVVPPETKCEI
AGWGESKGTENSVLNVASLNVISNQECNIKHRGRVRESEMCTKALLAPAGACEGDYRGPL
ACFTHDCWVLEGIIIPNRVCARPRWPAVFTRVSVFVDWIHKVMRLS
Download sequence
Identical sequences ENSPVAP00000008262 ENSPVAP00000008262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]