SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008460 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008460
Domain Number 1 Region: 29-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-36
Family Ankyrin repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 286-332
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000759
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008460   Gene: ENSPVAG00000008966   Transcript: ENSPVAT00000008966
Sequence length 333
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3896:61752:73588:1 gene:ENSPVAG00000008966 transcript:ENSPVAT00000008966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGPDGRAGPGPAGPNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE
SYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVV
NGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVTHHVTPDV
RPPFSRRLTSLVVCPLYISAAYHNLQCFQLLLQAGANPDFNCSGPVNTQGFHRGSPGCVM
DAVLRHGCEAAFVSLLVDFGANLNLVKWEALGPESRGRRKVDPTALVFHARSVPRALLSL
CRVAVRRALGKRRLHLIPSLPLPDPMKSFLLYQ
Download sequence
Identical sequences ENSPVAP00000008460 ENSPVAP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]