SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009570 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009570
Domain Number 1 Region: 191-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.000000333
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.27e-37
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-33
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 637-766
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-27
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 5 Region: 584-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000231
Family SH3-domain 0.00041
Further Details:      
 
Domain Number 6 Region: 782-833
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000171
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009570   Gene: ENSPVAG00000010144   Transcript: ENSPVAT00000010150
Sequence length 834
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1564:14815:321204:-1 gene:ENSPVAG00000010144 transcript:ENSPVAT00000010150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRARSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEDIYKGLPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCLENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQIFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTADPVEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFSRVTSCRVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRATSAEQGTLKPPEKRTNGLRRTPRQVDPGLPKMQVI
RNYTGTPPPGLHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHAAGQRGSRT
GNSLLSPKVLGIAIARYDFSARDMRELSLLKGDVVKIYTKLSANGWWRGEANGK
Download sequence
Identical sequences ENSPVAP00000009570 ENSPVAP00000009570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]