SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009690 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009690
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.85e-71
Family Eukaryotic proteases 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009690   Gene: ENSPVAG00000010277   Transcript: ENSPVAT00000010277
Sequence length 285
Comment pep:novel scaffold:pteVam1:scaffold_14970:11447:21714:-1 gene:ENSPVAG00000010277 transcript:ENSPVAT00000010277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWPWQASLLYHGRHICGAALIDVFWVISAAHCFQKSHEPSDYKILLGYHKLQHPTEHSLQ
MTVNRVIVHSDFNRSYFMGSDIALLQLHLSVNFTSHVLPACLPEPTTVLPSHTSCWITGW
GMVTEDELLAPPLQLQEGEVGIMDNNVCKMYFQGQSSSSQYSLHEDMLCAGDLITGKSIC
RGDSGGPLVCRLNNTWFLMGLSSWSLACRAPVSPSVFTKLTYFSSWILEKQTTTPNPDPA
SAPPQGKPPTLSDVTSLGTVHKPSICTILLFSQIFLLLLLFLKAL
Download sequence
Identical sequences ENSPVAP00000009690 ENSPVAP00000009690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]