SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009807 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009807
Domain Number 1 Region: 8-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-81
Family Eukaryotic proteases 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009807   Gene: ENSPVAG00000010407   Transcript: ENSPVAT00000010407
Sequence length 249
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2867:20568:23413:-1 gene:ENSPVAG00000010407 transcript:ENSPVAT00000010407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPLPAAILLSLALGFAAQDQGDRIIGGVPCTEGSHPWQVALLKGSQLHCGGVLVNEMW
VLTAAHCKMSEYNVFMGNDRLSSWRAQRIRATRSFVHPEYSRQTHVNDIMLVKLSSRARL
SSTVKKVNLPTRCEPPGTTCTVSGWGTTTSPTVTFPKELMCTDVKLISSEACRKVYKDLL
GKSMLCAGIPNSKTNACNGDSGGPLICRGTLQGLVSWGTFPCGQPNDPGVYTQVCKYTDW
INQTIRKHR
Download sequence
Identical sequences ENSPVAP00000009807 ENSPVAP00000009807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]