SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009979 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009979
Domain Number 1 Region: 38-124
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000719
Family Extracellular domain of cell surface receptors 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009979   Gene: ENSPVAG00000010591   Transcript: ENSPVAT00000010591
Sequence length 157
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3457:216566:244841:-1 gene:ENSPVAG00000010591 transcript:ENSPVAT00000010591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEPLAAPAAPLGGGGRLGGSIAATFCGLFLPQGLALQIQCYQCEEFQLNNDCSSPEFIV
NCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTP
LCNGPRPKKRSSSASALQPGLPTTILLLKLALFAGHC
Download sequence
Identical sequences ENSPVAP00000009979 ENSPVAP00000009979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]