SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010685 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010685
Domain Number 1 Region: 24-246,296-505
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.32e-69
Family Integrin alpha N-terminal domain 0.00000231
Further Details:      
 
Domain Number 2 Region: 855-1056
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-47
Family Integrin domains 0.00077
Further Details:      
 
Domain Number 3 Region: 505-667
Classification Level Classification E-value
Superfamily Integrin domains 2.41e-33
Family Integrin domains 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010685   Gene: ENSPVAG00000011333   Transcript: ENSPVAT00000011333
Sequence length 1129
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1068:444475:510095:1 gene:ENSPVAG00000011333 transcript:ENSPVAT00000011333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGQLWLLYLSAGLLPRLGAAFNLDTREDNVIRKTGDSGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTQPPREQSGTSPDVMMNSYLGFS
LDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVA
VVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGRWNNVKPIRLNGTKDSMFGIAV
KNIGDINQDGYPDIAVGAPYDEKGKVFIYHGSAKGINTKPTQVLEGNSRFFGYSIAGNMD
LDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGASSGICLKVKA
CFEYTAKPADYNPLISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTRELTMNKQKQKV
CMEETLWLQENIRDKLRPIPITASVEIQEPNSRRRVNSLPEVFPILNSNEPTTVHTDVHF
LKEGCGDDNVCNSNLKLEYKFCTRENQDKFSYLPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXQAMKHEDEVGSLIEYEFRVINLGKPLKNLGTATLNIQWPKEINNG
KWLLYLVKVESKGLEKIACEPQNEINLLDLKESHNSRKKREIAEKQIDDNRKFSLFAERK
YQTLNCSVNVKCVNIRCPLRGLDSKASVVLRSRLWNSTFLEEYSKMNYLDILVRASIDVT
AATENIKVPNAGTQVRVTVFPSKTVAQHSGVPWWIILVAVLAGILMLALLVLLLWKCGFF
KRSRYDDSVPRYHAVRIRKEEREIKDEKYNDNLEKKQWITRWNENESYS
Download sequence
Identical sequences ENSPVAP00000010685 ENSPVAP00000010685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]