SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010857 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010857
Domain Number 1 Region: 65-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-54
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 285-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000654
Family SOCS box-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010857   Gene: ENSPVAG00000011518   Transcript: ENSPVAT00000011517
Sequence length 329
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2190:102692:142879:-1 gene:ENSPVAG00000011518 transcript:ENSPVAT00000011517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLEESRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTIDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSASCTELLLEYGAKPQLESCLPSPTHEAASKGH
HECLEILISWGIDIDQDVPHLGTPLYVACMSQQFHCIRKLLHSGADVQKGKYWDTPLHAA
AQQSSMEAVNLLLEFGADINAKNTELLRPVDVAASSSLVERLLLQHEATPSSLCQLCRLC
IRSYIGRPRLHLIPQLQLPTLLQNFLQYR
Download sequence
Identical sequences ENSPVAP00000010857 ENSPVAP00000010857 XP_006916419.1.64745 XP_011369806.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]