SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011087 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011087
Domain Number 1 Region: 147-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-99
Family Protein kinases, catalytic subunit 0.0000000000182
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-25
Family Pleckstrin-homology domain (PH domain) 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011087   Gene: ENSPVAG00000011760   Transcript: ENSPVAT00000011760
Sequence length 471
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1445:74103:100709:-1 gene:ENSPVAG00000011760 transcript:ENSPVAT00000011760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKALLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDMDQRTHSP
Download sequence
Identical sequences ENSPVAP00000011087 ENSPVAP00000011087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]