SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011773 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011773
Domain Number 1 Region: 25-231
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-51
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000523
Family SOCS box-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011773   Gene: ENSPVAG00000012490   Transcript: ENSPVAT00000012489
Sequence length 286
Comment pep:novel genescaffold:pteVam1:GeneScaffold_673:228228:246938:-1 gene:ENSPVAG00000012490 transcript:ENSPVAT00000012489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEEEGPREVPDNALVSGSLMGDFVSDRTPVHEAAMRGRLLSLKYLIRQGWTVNLITAD
NVSPLHEACLGGHPSCVKMLLKHGAQVNGITSDWRTPLFNACVSGSHDCVNLLLQHGAIP
YPASDLASPIHEAAKRGHLKCIESLAAHGGDFDHNIGHLGTPLYLACENEHIACVKKLLD
SGANVNRGRGLDSPLHVVARGSNVDLARLLMDFGADPQARDDDGKRPSELVPSNSPLIEF
FLEHEGPPSLMQLCRLRIRKCFGVQQHYKIASLFLPEELKRFLLHI
Download sequence
Identical sequences ENSPVAP00000011773 ENSPVAP00000011773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]