SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012248 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012248
Domain Number 1 Region: 18-254
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.23e-58
Family Ankyrin repeat 0.0000756
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000628
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012248   Gene: ENSPVAG00000012990   Transcript: ENSPVAT00000012989
Sequence length 318
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1844:43311:64477:1 gene:ENSPVAG00000012990 transcript:ENSPVAT00000012989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE
RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRGDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHSANIDIQN
GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYNYGADT
NTRNYEGQTPLAVSLSISGSSRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDE
LPIAKVIKDYLKHKFDDI
Download sequence
Identical sequences ENSPVAP00000012248 XP_006924206.1.64745 XP_015454213.1.64745 XP_015454214.1.64745 ENSPVAP00000012248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]