SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014791 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000014791
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-98
Family Protein kinases, catalytic subunit 0.0000000000654
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-25
Family Pleckstrin-homology domain (PH domain) 0.000000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000014791   Gene: ENSPVAG00000015685   Transcript: ENSPVAT00000015685
Sequence length 480
Comment pep:novel scaffold:pteVam1:scaffold_11647:27255:44630:-1 gene:ENSPVAG00000015685 transcript:ENSPVAT00000015685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDAAVVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEHGESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSVAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYSQDHEKLFEL
ILVGEIRFPRSLGPEARALLSGLLKKDPKQRLGGGPEDAKEIMQHRFFAGIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences ENSPVAP00000014791 ENSPVAP00000014791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]