SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015040 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015040
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.1e-43
Family N-terminal domain of cbl (N-cbl) 0.00018
Further Details:      
 
Domain Number 2 Region: 234-307
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-38
Family SH2 domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 5.64e-38
Family EF-hand modules in multidomain proteins 0.00012
Further Details:      
 
Domain Number 4 Region: 335-380
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-21
Family RING finger domain, C3HC4 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015040   Gene: ENSPVAG00000015937   Transcript: ENSPVAT00000015938
Sequence length 477
Comment pep:novel genescaffold:pteVam1:GeneScaffold_4001:56292:69801:1 gene:ENSPVAG00000015937 transcript:ENSPVAT00000015938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAPRGWQWGEARAVDRAVRLLQRLEEQCGDPRLTSSPPSLRDLLPRTAQLLREVAQ
ARRRAGRDGPEDPGGARDFLVIYLANLVAKSRQVAALLPPPGRRSASDELFREGSTLRRQ
LAKLALIFSHMLTELSALFPGGKYCGHTYQLTKAPAHAFWRKHCGAQCVLPWAEFESLLC
TCHPVEPGSTALALRSTIDLTCSGHVSIFEFDIFTRLFQPWPTLLDNWKLLAVNHPGYMA
FLTYDEVRARLQACREKPGSYIFRPSCTRLGQWAIGYVNSDGSILQTIPLNKPLLTALLE
GQKEGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQLQLYWAMDSTFELCKICAESNKN
VKIEPCGHLLCSRCLATWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVTPLPPPLPPRLDLFPDSPRIKGQLKAKLLKGNTPPAAPVGPRTTAQAW
Download sequence
Identical sequences ENSPVAP00000015040 ENSPVAP00000015040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]