SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015346 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015346
Domain Number 1 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 14-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 3 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000015346
Domain Number - Region: 205-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00627
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 402-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0214
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015346   Gene: ENSPVAG00000016268   Transcript: ENSPVAT00000016266
Sequence length 430
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3287:10880:33703:1 gene:ENSPVAG00000016268 transcript:ENSPVAT00000016266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEMNDESQIVRSQESLTFQDVAVDFTREEWDQLYPAQKKLYRDVMLENYRNLVTLGH
QLKPKVITQLEQEEQWMMERDSPLDHPDGENKPEIKKSTPNQNISDENKTHDMIMERLAG
DSFWYSILGRLWDFDYQLEFNQENQQRHLGQVSLTPKKVTQERSLECNRFGENYKMNSDL
IMNQRTSSIKIPFNSDTQGNSIKYNSELVDYQGNYIRENIYDYNEYGNIFSQHIIFTNHI
HAEEKPSECKVAFSHNSSFTQPQIVLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKPF
ICNGCGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHHRLHTGEKPYECSF
CGKAFSQRTHLNQHERTHTGEKPYKCNECDKAFSQSAHLNQHRKIHTREKLCEYNKCEKA
LSHSPSLSNM
Download sequence
Identical sequences ENSPVAP00000015346 ENSPVAP00000015346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]