SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015925 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015925
Domain Number 1 Region: 30-125
Classification Level Classification E-value
Superfamily Snake toxin-like 8.93e-24
Family Extracellular domain of cell surface receptors 0.031
Further Details:      
 
Domain Number 2 Region: 138-227
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000997
Family Extracellular domain of cell surface receptors 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015925   Gene: ENSPVAG00000016885   Transcript: ENSPVAT00000016885
Sequence length 345
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1288:5599:8988:-1 gene:ENSPVAG00000016885 transcript:ENSPVAT00000016885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTRKAGALAVIWTTGWLLLLQMLLLREGAQALECYSCVQKADDGCSPQKMKTVKCAPG
VEVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLYGLLAFIQLQQCAQDRCNAKI
NLSTRALNPAGNESAYEPNGAECYSCVGLSREACQGTAPPVVSCYNASDRVYKGCFDGNV
TLTAANVTVSLPVRGCVQDELCTRDSATGPGFILSGSCCKGSRCNSDLRNKTYFSSKFPP
LVLLPAPHPTTLAPTTPVTTSAPAPTMRTSATKPTLASTSQTPPKEVEPETSHKEESSLP
GGAAGHQDRSNVEQYPAKGGAHNKGSAAPSAGLAALLLAVAAGAL
Download sequence
Identical sequences ENSPVAP00000015925 ENSPVAP00000015925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]