SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016244 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016244
Domain Number 1 Region: 528-638
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 291-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000183
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 167-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000183
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 4 Region: 704-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000106
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 644-702
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 345-460
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000144
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 
Domain Number 7 Region: 772-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000301
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 465-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016244   Gene: ENSPVAG00000017219   Transcript: ENSPVAT00000017219
Sequence length 911
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3779:146753:163177:-1 gene:ENSPVAG00000017219 transcript:ENSPVAT00000017219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKAQHPPPPQLLFLILLSCPWIQGLPLKEEEALPEPGSETPRVTSEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKAGSGAGPTAP
ELLTPPPGTTAPPLPGPASPGLPLGPEGEEETTTTIITTTTVTTTVTNPVLCNNNINNIS
EGEGHVESPDLGSSASRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSREEELLVLAGGGSP
GLAPQLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGSGFRIHYQAYLLSCGFPPRPAH
GDVSVTDLHPGGTATFHCDSGYQLQGEETVVCLNGTRPAWSGEPPSCIASCGGTIHNATL
GRIVSPEPGGAAGPNLTCRWVIEAAEGRRLLHFERVSLDEDNDRLMVRSGGSPLSPVIYD
SDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDP
EYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVL
SPDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSTRVLAQLRGP
QPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASH
GDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTTS
DAGFPVGSHVQYRCLPGYSLEGASVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPEN
GYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQ
LEGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYE
AGDTREYEVSI
Download sequence
Identical sequences ENSPVAP00000016244 ENSPVAP00000016244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]