SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016278 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016278
Domain Number 1 Region: 1147-1342
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 102-162
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-17
Family PDZ domain 0.016
Further Details:      
 
Domain Number 3 Region: 1003-1060
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000186
Family Pleckstrin-homology domain (PH domain) 0.0000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016278   Gene: ENSPVAG00000017255   Transcript: ENSPVAT00000017255
Sequence length 1960
Comment pep:novel genescaffold:pteVam1:GeneScaffold_845:15378:123908:-1 gene:ENSPVAG00000017255 transcript:ENSPVAT00000017255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDTLKARVSPACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXAIQFYMDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAG
LCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAY
SQDAYLKGNEAYSGNARNIPEPPPVCYPWLPPSAPSATAQPVEVSPPDLSSSKQQTSTPV
QTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLTNRNNHTVPSH
RTEEVRYGASEPSLKTVSRTTSPSSSIPTAHPIHQTAGSRSLEPSRILLKSGHYSGHSEG
ISSNRSPAVDSPSVTVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLRA
ASQSTTDYNQVVPNRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSAS
QGALTAPPISFSNHRTRSWDYIEGQGETLENVTSESQIPDSNGERKQTYKWSGFTEQDDR
RGIYERPRQQEIHKAFRGSNFTVAPSVVNSDNRRMSGRGVGSGSQFKKIPPDLKTLQSNR
NFQAACGMSLPQGISQDRSPLVKVRSNSLKAPSSHVTKPSFSQNSFVSIKDQRPVNHLHQ
NSLLTQQTWLRTGSAPDQQVEAGKTPSFSGASVKPVLQMGENSGTSEVELPVTQRNQELN
LQEVEIQQSNNLDNKETVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDA
RREVHIKRIEERKASSTSPPGDSLASIPFIDEPTSPSIDHDISHIPASAVISASTSQAPS
IATVPPSLTTSAPIIRRQLSHDQESVGPPSLDAQPNAKTERSKSYDEGLDDYREDAKLSF
KHISSLKGIKSTDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYSETKRKNVFRLTTSDCE
CLFQAEDRDDMLAWIKAIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQ
SLSIRQTLLGTKSEPKTQSPHSPKEDSERRLLSKDDTSPPKDKGTWRKGIPSIMRKPFEK
KPAATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQE
ELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLK
TLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNNMEPRNLAIVFGPTLVRTSEDNMTHM
VTHMPDQYKIVETLIQHHDWFFTEDGAEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTGV
PPGDVSDSATSDSTKSKGSWGPGKEQYSRDLLVSSIFAAASRKRKKPKEKAQPSSSEDEL
DNVFFKKENAEQRHSDTKEESKKDSETLGRKQRAVLAKENNAKKDSSATKDDKTSGRKES
LPSEEHSPHHASRLSKSPTPSGRLAILKDSPGSLVTQKSSHFEETGSDSGTLLSTSSQAS
LARFSTKKSTSPETRHGEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGD
EADDERSELISEGRPVETDSENDFPVFPAALTSERFFRGKLQEVTKTSRRNSEGSEVSCT
EGSLTPSLDGRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGEAKNEKETPSITKVFDVM
KKGKSTGSLLAPTRSDSEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKTNPETTKRKN
IKRRHTLGGHRDATEISVLNFWKAHEQSGERESELSAVSRLKPKCSAQDLSISDWLARER
FRTSTSDLRGETGDSQPDSTSTLEGSMMDAPVSFHSDAGSSSSTLASAHRPLLSIPPQSP
DQINGESCQNTSQNASSAANAQPHKLSESPGNKAELHPCL
Download sequence
Identical sequences ENSPVAP00000016278 ENSPVAP00000016278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]