SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016363 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016363
Domain Number 1 Region: 23-88
Classification Level Classification E-value
Superfamily WWE domain 2.22e-18
Family WWE domain 0.0031
Further Details:      
 
Domain Number 2 Region: 393-491
Classification Level Classification E-value
Superfamily RING/U-box 4.59e-18
Family RING finger domain, C3HC4 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016363   Gene: ENSPVAG00000017343   Transcript: ENSPVAT00000017343
Sequence length 621
Comment pep:novel genescaffold:pteVam1:GeneScaffold_508:226349:257385:1 gene:ENSPVAG00000017343 transcript:ENSPVAT00000017343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGQGVMMPVTGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRAASNAILASQRRKAPPAAPPLPLPPPGG
PPGSLVVRPSATFAGTALWATPATATGPTEPAQSPGAPPRSPSAPSGAPTPGQNNLNRPG
PQRATSVSTRASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPIL
HPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERL
VTASGYEGVLRHKGVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEK
TATQPPGMEFHLIPHSLPGFADTQTIRIVYDIPTGIQSPEHPNPGKKFTARGFPRHCYLP
NNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDAS
YLDNVLAELTAQGVSEAAAKA
Download sequence
Identical sequences ENSPVAP00000016363 ENSPVAP00000016363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]