SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016742 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016742
Domain Number 1 Region: 34-222,261-514
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.22e-74
Family Integrin alpha N-terminal domain 0.00000186
Further Details:      
 
Domain Number 2 Region: 885-1080
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-35
Family Integrin domains 0.0021
Further Details:      
 
Domain Number 3 Region: 514-680
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-32
Family Integrin domains 0.0056
Further Details:      
 
Domain Number 4 Region: 681-830
Classification Level Classification E-value
Superfamily Integrin domains 1.75e-20
Family Integrin domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016742   Gene: ENSPVAG00000017746   Transcript: ENSPVAT00000017747
Sequence length 1176
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2993:12260:31215:-1 gene:ENSPVAG00000017746 transcript:ENSPVAT00000017747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIPGRDPMGVSGICYLLGSLLLGLLSPGAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAIHDELDGGE
WKFCEGRPQGHEQFGFCQQGAAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLHL
DDGPYAGGEKEDPRLIPVPANSYFWLLFVTNIDSSDPDQLVYKTLDPADQLPGPAGDLAL
NSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERLTSG
FGYSLAVTDLNNDGWADLVVGAPYFFERQEELGGAVYVYMNQGGHWAGVSPLRLCGSPES
MFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVVKPSQVLEGEAVGIKSF
GYSLSGGLDVDGNHYPDLLVGSLADAAVLFRARPVLHVSHEVFIAPRNIDLEQPNCAGGH
SVCVDLRVCFSYIAVPSSYNPIVALDYVLDGDTDRRLRGQVPRVTFLSRGLDDPKHQASG
TVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYSLQTPRLRRQAPGQGLPLVAPILN
AHQPSTQRAEIHFLKQGCGEDKICQSNLQLVHARFCARVSDTEFQPLPMDVDGTTALFAL
SGQPVIGLELKVTNLPSDPAQPQADGDDAHEAQLLVSLPASLHYSGVRALDPAEKPLCLS
NENASHVECELGNPMKRDAQITFYLILSTSGITIETELEVELLLATISEELHPVSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSNQGQSLNTLGSAFL
NIMWPHEVANGKWLLYPMRVELEGGQGPGPKGLCSPRPNILRLDVDNRDRRRRELEQPEQ
QEPHEQLEPSTSWWPVSSAEKKKNITLDCARNTANCIIFSCPLYSFDRAAVLHVWGRLWN
STFLEEYSAVKSLEVIVRANITVKSSIKNLVLRDASTVIPVMVYLDPVAVVAEGVPWWVI
LLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVPQYHAVKIPREDRQQFKEEKTGTILR
SNWGSPRREGPDAHPILAADGHPELGSDGHSGPGTA
Download sequence
Identical sequences ENSPVAP00000016742 ENSPVAP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]