SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016993 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016993
Domain Number 1 Region: 9-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000335
Family Snake venom toxins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016993   Gene: ENSPVAG00000024100   Transcript: ENSPVAT00000024267
Sequence length 116
Comment pep:novel scaffold:pteVam1:scaffold_89906:78:794:-1 gene:ENSPVAG00000024100 transcript:ENSPVAT00000024267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLALFLVALPLAQALDCHVCSYNGENCFNPMRSMRCPAMVTYCMTTRTYYTPTKMKV
SKSCMPSCFETVYDGYSKHASTTSCCQYDLCNGAGLATPGALALAPILLATLWGLL
Download sequence
Identical sequences ENSPVAP00000016993 ENSPVAP00000016993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]