SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0MBM9_9ENTO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0MBM9_9ENTO
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.49e-22
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0MBM9_9ENTO
Sequence length 73
Comment AC=A0MBM9; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Human coxsackievirus A6. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Enterovirus; Human enterovirus A.
Sequence
AQVSVPFMSPATAYQWFYDGYPTFGEHKQATNLQYGQCPNNMMGHFAIRTVSESTTGKNV
HVRVYMRMKHVRA
Download sequence
Identical sequences A0MBM9
A0MBM9_9ENTO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]