SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0PD61_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0PD61_9CALI
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.24e-21
Family Caliciviridae-like VP 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0PD61_9CALI
Sequence length 132
Comment AC=A0PD61; DE=SubName: Full=Polyprotein; Flags: Fragment; GN=Name=ORF1; OS=Sapovirus Hu/Chiba/040507/2004/JP. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Sapovirus.
Sequence
MEGVSRPEGPRANSNENVPLASPQDTIGPSAALLLPTQIETPNGAAQRVEMAAATGAISN
NVPMCVRECFASVTTLPWTTRQASNTFLGAIHLGPRINPYTAHLSAMFAGWGGSFQIRVT
LSGSGLYAGRAV
Download sequence
Identical sequences A0PD61
A0PD61_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]