SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0SWJ7_9GEMI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0SWJ7_9GEMI
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Origin of replication-binding domain, RBD-like 6.13e-56
Family DNA-binding domain of REP protein 0.00000146
Further Details:      
 
Weak hits

Sequence:  A0SWJ7_9GEMI
Domain Number - Region: 193-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0304
Family Nucleotide and nucleoside kinases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0SWJ7_9GEMI
Sequence length 357
Comment AC=A0SWJ7; DE=SubName: Full=Rep; GN=Name=C1; OS=Tomato yellow leaf curl virus. OC=Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
Sequence
MPRLFKIYAKNYFLTYPNCSLSKEEALSQLKNLETPTNKKYIKVCRELHENGEPHLHVLI
QFEGKYQCKNQRFFDLVSPNRSAHFHPNIQAAKSSTDVKTYVEKDGDFIDFGVFQIDGRS
ARGGQQSANDAYAEALNSGSKSAALNILKEKAPKDYILQFHNLSSNLDRIFSPPLEVYVS
PFLSSSFNQVPDELEEWVAENVVSSAARPWRPISIVIEGDSRTGKTMWARSLGPHNYLCG
HLDLSPKVYSNDAWYNVVDDVDPHYLKHFKEFMGAQRDWQSNTKYGKPIQIKGGIPTIFL
CNPGPTSSFREYLDEEKNISLKNWALKNATFVTLYEPLFASINQGPTQDSQEETNKA
Download sequence
Identical sequences A0SWJ7
A0SWJ7_9GEMI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]