SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0ZXC7_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0ZXC7_9PICO
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.12e-77
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0ZXC7_9PICO
Sequence length 213
Comment AC=A0ZXC7; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Foot-and-mouth disease virus - type A. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
TTATGESADPVTTTVENYGGETQVQRRHHTDVGFIMDRFVKINSPKSTHVIDLMQTHQHG
LVGALLRAATYYFSDLEIVARHDGNLTWVPNGAPVSALSNTSNPTAYNKAPFTRLALPYT
APHRVLATVYNGTSKYTVSGSSRRGDLGALAARVAKALPASFNYGAIKADNVHELLVRMK
RAELYCPRPLLAIEVSSQDRHKQKIIAPEKQLL
Download sequence
Identical sequences A0ZXC7 I0AYW4
A0ZXC7_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]