SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1JXF7_9HEPC from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1JXF7_9HEPC
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.82e-109
Family Viral proteases 0.0000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1JXF7_9HEPC
Sequence length 181
Comment AC=A1JXF7; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Hepatitis C virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Flaviviridae; OC=Hepacivirus.
Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAG
SKTLAGPNGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
S
Download sequence
Identical sequences A1JXF7
A1JXF7_9HEPC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]