SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A4L237_9VIRU from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4L237_9VIRU
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000644
Family Nucleotide and nucleoside kinases 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4L237_9VIRU
Sequence length 235
Comment AC=A4L237; DE=SubName: Full=Putative guanylate kinase; GN=Name=gk; OS=Gryllus bimaculatus nudivirus. OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses; OC=Nudivirus.
Sequence
MSSYYRVFVGGPSAVGKTTLLNYIYERYEDARVSDMSFETLQDGKKTAKEIAEELATKRN
EDLIYEHSPLCMKLYQLIFKYKKNLRKKSNDTIVDFWNECLNVSTTPIYDNIFIIIDTTE
FLKKRFYNRSYNNIDWLDDMYLYLQTIAYVSLMRKRHLYQGCRFVVIYDPNETSPNCLFG
IRDALNLKNIIDSYFVPGVDFKFPYELNKKRIAEEIMMHHTLSLRGRTNLVLFKS
Download sequence
Identical sequences A4L237
gi|134303472|ref|YP_001111341.1| A4L237_9VIRU YP_001111341.1.20560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]