SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5A2U5_BYDVP from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5A2U5_BYDVP
Domain Number - Region: 97-196
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00269
Family Tombusviridae-like VP 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5A2U5_BYDVP
Sequence length 200
Comment AC=A5A2U5; DE=SubName: Full=Coat protein; OS=Barley yellow dwarf virus (isolate PAV) (BYDV). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Luteoviridae; OC=Luteovirus.
Sequence
MNSVGRRGPRRANQNGTRRRRRRTVRPVVVVQPNRAGPRRRNGRRKGRGGANPVFRPTGG
TEVFVFSVDNLKANSSGAIKFGPSLSQCPALSDGILKSYHRYKITSIRVEFKSHASATTA
GAIFIELDTACKQSALGSYINSFTISRTASKVFRAEAINGKEFQESSIDQFWMLYKANGT
TTDTAGQFIITMSVSLMTAK
Download sequence
Identical sequences A5A2U5
A5A2U5_BYDVP

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]