SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5GXK9_9BROM from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5GXK9_9BROM
Domain Number 1 Region: 29-218
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.56e-92
Family Bromoviridae-like VP 0.0000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5GXK9_9BROM
Sequence length 218
Comment AC=A5GXK9; DE=SubName: Full=Coat protein; GN=Name=CP; OS=Cucumber mosaic virus (cucumber mosaic cucumovirus). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Bromoviridae; OC=Cucumovirus.
Sequence
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFVG
SERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRIQIRVNPLPKFDST
VWMTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANSKLLYDLSAMRADIGDM
RKYAVLVYSKDDALETDELVLHVDVEHQRIPTSGVLPV
Download sequence
Identical sequences A5GXK9
A5GXK9_9BROM

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]