SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5H9V9_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5H9V9_9PICO
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000000000876
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5H9V9_9PICO
Sequence length 110
Comment AC=A5H9V9; DE=SubName: Full=Capsid protein VP1; Flags: Fragment; OS=Hepatitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Hepatovirus.
Sequence
VSTEQNVPDPQVGITTMRDLKGKANRGKMDVSGVQPPVGAITPIEDPVLAKKVPETFPEL
KPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTFPITLSSTSNPPH
Download sequence
Identical sequences A5H9V9
A5H9V9_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]