SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7RBT2_PBCVA from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7RBT2_PBCVA
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000555
Family ABC transporter ATPase domain-like 0.029
Further Details:      
 
Domain Number 2 Region: 12-40,188-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000808
Family ABC transporter ATPase domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7RBT2_PBCVA
Sequence length 254
Comment AC=A7RBT2; DE=SubName: Full=Putative uncharacterized protein C479R; GN=Name=C479R; ORFNames=AR158_C479R; OS=Paramecium bursaria Chlorella virus AR158 (PBCV-AR158). OC=Viruses; dsDNA viruses, no RNA stage; Phycodnaviridae; Chlorovirus; OC=unclassified Chlorovirus.
Sequence
MSYSITQFDPRSIGDGNIIGVVGRRGSGKSVIIKDLLYYKRNSLPLGLVMSGTEAGNGYF
SKFVPEIFVYDDFNKDALEKLLERQKKAAKKGKLSKVFVVLDDLAFDSSIMKQPVMRYIF
MNGRHLNIFLIFSSQYVSDLGPPAIRANIDILLVCREAIQANRWRLYNMFFGCFPSFEDF
NKVLNACTENYGVLVLDNTKLSNDPQDCVFHFKATMRDNFRMGAHAFWRFSKERKRDEDS
DEEDNGVRLIKNKK
Download sequence
Identical sequences A7RBT2 M1H7Q7 M1HGK8 M1HHI8 M1HQX8
gi|157953669|ref|YP_001498560.1| YP_001498560.1.50092 A7RBT2_PBCVA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]