SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D3XFK8_9VIRU from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D3XFK8_9VIRU
Domain Number - Region: 10-93
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0275
Family P40 nucleoprotein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3XFK8_9VIRU
Sequence length 193
Comment AC=D3XFK8; DE=SubName: Full=Coat protein; OS=Apple chlorotic leaf spot virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Tymovirales; OC=Betaflexiviridae; Trichovirus.
Sequence
MAAVLNLQLKVDADLKAFLVAEGRPLHGKTGVILEQMLESIFANTAIQGTSEQTEFLDLM
VEVKSMEDQKVIGSYNLKEIVNMIKAFRTTSSDPNINNMTFRQVCEAFAPEARNGLVKLK
YKGVFTNLFTTMPEVGSKYPELMFDFNKGLNMFIMNKAQQKVITNMNRRLLQTEFAKSEN
EAKLSSVSTDLCI
Download sequence
Identical sequences D3XFK8
D3XFK8_9VIRU

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]