SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O10682_BDV from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O10682_BDV
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily P40 nucleoprotein 6.28e-70
Family P40 nucleoprotein 0.0000000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O10682_BDV
Sequence length 146
Comment AC=O10682; DE=SubName: Full=P40; Flags: Fragment; OS=Borna disease virus (BDV). OC=Viruses; ssRNA negative-strand viruses; Mononegavirales; Bornaviridae; OC=Bornavirus.
Sequence
LVFLCLLIPGLHAACVHGGVPRESYLSTPVTRGEQTVVKTAKFYGEKTTQRDLTELEISS
IFSHCCSLLIGVVIGSSSKIKAGAEQIKKRFKTMMAALNRPSHGETATLLQMFNPHEAID
WINGQPWVGPFVLSLLTTDFESPGKE
Download sequence
Identical sequences O10682
O10682_BDV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]