SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1YQ99_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1YQ99_9CALI
Domain Number 1 Region: 25-158
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.41e-52
Family Caliciviridae-like VP 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1YQ99_9CALI
Sequence length 158
Comment AC=A1YQ99; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/GII/733/2006/HKG. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAP
GGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGGFEVQVILAGNAFTAGKII
FAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPL
Download sequence
Identical sequences A1YQ98 A1YQ99
A1YQ98_9CALI A1YQ99_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]