SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5A104_9VIRU from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5A104_9VIRU
Domain Number 1 Region: 2470-2969
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.01e-104
Family RNA-dependent RNA-polymerase 0.00019
Further Details:      
 
Domain Number 2 Region: 595-814
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.74e-35
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.004
Further Details:      
 
Domain Number 3 Region: 250-511
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 8.56e-30
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.036
Further Details:      
 
Domain Number 4 Region: 2213-2429
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.86e-28
Family Viral cysteine protease of trypsin fold 0.02
Further Details:      
 
Domain Number 5 Region: 997-1251
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.85e-24
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5A104_9VIRU
Sequence length 2983
Comment AC=A5A104; DE=SubName: Full=Polyprotein; OS=Brevicoryne brassicae picorna-like virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Iflaviridae; Iflavirus; unclassified Iflavirus.
Sequence
MMSVQNKNFVVSSSTTASPSCSTGSSEDYSSEIGSTNVGTCYQHIDSLGYQYARCAEKIE
KYESRKIDLLKILKDLRAKEAQLNIVPPPTVPKSIPVPKSIVNPCKLDNRSYSEVASIPI
SSSEEELIFNYPIAYSNKLRINKLQKQYDLNEWRIKKQLKRRTKLNKLMLNQVQYSPIYN
YHIDNTNNSVYNPTTVPIPDSYQPFPARPTSSKHIKIRKDRNSINDSIFGLYIPTPIATR
DPILSIKLRCIIRSFRNVVNSSYIKFLIFHKYRLLPSYKSTPPPIVCYPQMDAHGEDSNN
IGPDKKLNTVVSSQRDTSEGVSNKVVYPAWQDLVSSDHYSSYPTSISRWTKYKTIQWLST
GMSNSSISVPSDLLTEFVNTPVFIPFRNNRLWRGDLEFKFVLNSNKFQQGSLQVSFIYCA
SLEQSFNVYRDNVYSASQTNHCILNAGSSNEGILKIPFKYYNPVITTNPKENVDYCKIFI
RVLNVLRCTSTTYGACDLTIFVNFDNAYFTGSIDFSLIQNPQMFHLMRALVKTAEFGLNQ
LDPDANRDNPPDISTPSPVVISNASSWCVGNTAVDQLNHLRLVSTGQTPHPNLEHDELKT
NVISRIFGLVKTLDWSFNHQVGHLLFNLEAAPMGALTQYYSSSVTVANRDYLLYNFPPVT
ILSNLYAYWRGTLELRLDFVATSFHTGSLLIAYIPGIKSNVTLDQARSSNYVVCSLQEQQ
SYTVRIPYIANSPCWPRKYNKSYKIKIVVEINPPGSLQIFVLNPLIPLDSVHSSIEINCY
LRAGVDFELLVPIQPNISTPYNLDYKDAQYNELPLSNADLVEKKTTIYYCCSSPINYPGM
ITLTSSDPSSNNLIMYESLRDGSYINNKKRITDLNNYVPNVPGIFNFYLSSSLSVTFKYQ
QKSSTSNFITSNCKFFVLYNELCSSEGTTTLWVVRDEEAAKRYARSEQSWDDLMKAVINC
VGISDTHSDTNAFTYLTKIFVHKHTTNLCSSLSSSYSDITVPNNEERSLSTNFLDMTQNL
QSTSHGLNLFGEDFSDLKDYCRRYQYYTNINCKLSSSYIKKQAVAVIPLVPQGLINSVIY
PDHSINHIVNRCKDGFIPIISSGYRFFRGGLRFRIVCDSRRNVNLWVQHRPEMLLKYLQP
HMTDIDNQSLSDYFNHSYSFNIQNLSLNNVVSLEVPWYSKNMLGCSFFPKVISSDTDINS
QNLTSFSLGSLILGLDYDKTETTNPLNLDIYYSLADDFHFNTFQGFPLMLTLEQIPNTYA
LPQMGIFNKLISDTPTAKKVDMVTEKAEKLIDNISDCFSALPNLIESNFNNVETCFKVVL
HDIFYGILHCIVSPCVKTFCLVICSIFTKVGVLAVEGIWKLAKLLKRFYKFFIGAVSEDA
QQTDDQPSTSKVLPQADTQDEDPSSICAGIVSIIWAGVNTMLNVTFKSCESLGDCANMLM
SGITKGANHANTMFRFVKNIFGVLEKMYKSVINKIFAKYDKYNRLKVEEETLREWLDLCD
NLLSPANSTLVQNDIQWREAVYCAARYGHIYLSKQKAGATPRVDMYIRKVYDKIINLRDS
LQKEKLFPSLRMEAYGLWLDGKPGIGKSSMITKLSTDLLNSINYKSDSGLIFNVTPLDKY
WSTCDHQPVLTIDDAFAIQTPECIQNQLWAYFSVMSPVPLIPPMAEIKDKKNHYNPEIMI
TCSNNAFPRLPGIAEPKALYRRRHQLIRVQLKKPECPNYPFGFTVEEVNELKHLEFAVAT
DVRVEGTYKGAYSYNELIKMLIKDFHKFKERSAAAYEERKRLQFSMLTDSQAKKLPETKK
ISEYLKEIDTKHQEEIAKQKLDFATVEETVKAIDEIQSHADFSLRWRADTSLLLPGAKTV
EENAAVVDEKAAQVSDPESDTGGAVVFEVPDTLTNEQLIAAFDPLTPEELAEFDRSRQDM
REMENETNRKIKEVIKKSKLMEFEDKIGQDISRTVPERIQFLCKFSSFASYILRMGTADN
APSSNAQNNFLLALRVYNNNVPCKDKINMLGDICSKRCVHYLIKYCTSYRIERKFGLRYP
VWEVPIKYDPISQEFVYSKYSNQILNVSDFLCSDPNCIVNRPSEWLKLVSQWLSWGLKYA
PWCAYSKDCPVVSCAVSKISKFRKFINAIQYAIVSTVKFCLYDVFYNSIHWLGTVFITVG
GFLSGLAGILGLVGLFKVPRPQLVSSGDTVTKAGTANVRKIIFGQFNPGPQSSVSNNNLE
LISSVYNRINRNTVYINYEDKVLNKISHMKCIVIKERYVIVLRHYIEYLECNATDTSNVN
ITWADCGSYPFNYKDYKIYWCENSNIGVLRLGNWFSARRSLIPFITKSDSFLGNAGRECV
ILDVKLSESYVYNENIKLVDNVTIAPTSYSKMLIMPNAYMYKKNYPGMCGSVLMNEATNT
PILGIHVAGANGKGFSEPICRAQFDSLFQHIEKGIVEDVIPTDWRELETRFIPVDQRKLF
LSGTHTYLGNIDPNIAKYEAGVSSIVPSTIQGVFPIGTEPGPLTPRDPRINGEFSPLLTG
CEKHCNPTIDFNKEDLAYAESDLSSLIIANCKPIRVSCHALTELQAVNGIPDLEGYQSMT
WNTSEGFYLSRLRPKNAHDKRWLFNFDKNGQVVSLHPYLREILDIKMSDRLSGIVPATVH
DDCLKDARLPLSKIKIPGKVRVFSISPVDFTIQFRQYFLDFIASYTKARFNCEHAIGINV
HGYEWSELAHFFEGKKLITGDYSGFGPSLNSEVVTAAFRIICKWYKQYGCSVEDNHIRMM
MSKELINAKHLMRDYLYEVQCGLPSGNPATVIFNSIVNSIYIRCAWLDVMRNSSYKSLLD
FRNNIKLITYGDDLIASIDNSVSDKFNNNSLSHFFLKHNIKFTDAAKTGVNVEPYIYLET
ATFLKHAFKPHPIRQGVYLAQLEELSITECANWIRKSPDPKTATYDNCVQGTMLAYGHGP
DYYNRYVKKISEAWFEKYEEEFVVRTWSELDHLFLVEGMFIDW
Download sequence
Identical sequences A5A104
YP_001285409.1.11873 A5A104_9VIRU gi|148717938|ref|YP_001285409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]