SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6N312_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6N312_9CALI
Domain Number 1 Region: 25-74
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000000000942
Family Caliciviridae-like VP 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6N312_9CALI
Sequence length 74
Comment AC=A6N312; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/CMH063/04/2004/THA. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAP
GGEFTVSPRNAPGE
Download sequence
Identical sequences A6N303 A6N305 A6N306 A6N307 A6N308 A6N309 A6N310 A6N311 A6N312 A6N313 A6N314 A6N315 A6N316 A6N321 Q0WY64
A6N303_9CALI A6N305_9CALI A6N306_9CALI A6N307_9CALI A6N308_9CALI A6N309_9CALI A6N310_9CALI A6N311_9CALI A6N312_9CALI A6N313_9CALI A6N314_9CALI A6N315_9CALI A6N316_9CALI A6N321_9CALI Q0WY64_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]