SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7LM73_9VIRU from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7LM73_9VIRU
Domain Number 1 Region: 2447-2956
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.88e-94
Family RNA-dependent RNA-polymerase 0.00035
Further Details:      
 
Domain Number 2 Region: 879-1131
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.85e-68
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.02
Further Details:      
 
Domain Number 3 Region: 522-700
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.06e-33
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0019
Further Details:      
 
Domain Number 4 Region: 183-425
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.06e-27
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.017
Further Details:      
 
Domain Number 5 Region: 2229-2421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000103
Family Viral cysteine protease of trypsin fold 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7LM73_9VIRU
Sequence length 2964
Comment AC=A7LM73; DE=SubName: Full=Polyprotein; OS=Slow bee paralysis virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Iflaviridae; Iflavirus; unclassified Iflavirus.
Sequence
MEHTPLLSSFPITLLDHCGGNRKIHWTRCYEQKYWLPFSCCKVASRLPCVNVRRSYMWYS
KKQSKWIYLSESDFRACKAGIYKRREEQEKEKLWSELCDICSWECFEYYKFRDQRLLLLL
RKKIADKAQCRCRTNCKLVTIKHGYVRRVKTIEPCEAIELTNAETFGSNLDFAQPEMDRP
EGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLASSEVSDEYPMLTDRWLFWKSVK
WEVNDSAFGKMLVQEKFPQSWVQMDVNVNNIPRYTNIPNFIPFNIHQYMRADFEVKIYVN
PNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQMPHVLVNVGAANEATLKIPYRYVRPF
MRCKDILRGDNLITGVTEPLNMGVLFVEVLIPFRTSAASSAPKSLDVSLFVKMTNAKFTG
MVDGSIALLSKPIALPEMDRILDNGLGVVSKLLKDVNCDNPPDPTPAKFFVPIPSHSWAH
GTNTSEPTNTLRLDGGVVGVGRSDDIGTSDTAISGIIGVYGLLKPFDWNANDTGRNVGGH
LLWSMPVHPQVDKDQVIQVMTQSKLTQYYLPPISVVSSLYAYTRGSIKYKFLFGNNPRHN
ARLLVAYIPGISSDNRLTLERARNSAHVVFSLNEVSEFVFTVPYITDTMWWPRKYGGPQA
AGEFVAPSYICMFILNPLVAMESVPSIVTIVPMIAAGDDFEVAVPAQPAVGLSRNIDVIY
PKDSIISFKSGYFPVYVGSWHSFFDSTKAILRYGAVSDHIAQLGNIPANVNRKAFWIVVG
DTIKFKTKLDKINGTEWFIPEGEYTLGYGVVWRDGAYAYMVPYPLTPLGEKIAQYTASLL
ASNTAISQIRPYIPDYIVDSAASKDNILWSPIEDRLRAQTEWVMAEPEMERTFTPNVMQP
TPLLPTTNDGRVTFGEAFNDLKDLARRYQLYWEGTILEGNLRAIRRNSALVQLPLYPHGL
RIQPDVNNPIWNIMRDGHIPVISSGFRYFRGGLRLRIVVEGLNSCVWVQHHPDRPSIFSR
PIIGRYIAAKDAYRNHAYAAYVQNMSVNRTIEVEVPFYQPGLYGMLNASDNNTANSFDRL
RFTGLGDLLIGIEGEQPIPKEGIEISVYYSIADDFSFNIFCGFPPMVYCDETYSAATPDL
AQYFEDEVTIAQPEMMMSMCQGFVGSLIGHHLQRATTYGIESAKESIRDVVKDEFKTQIK
PELDNLNKVIGEAANSIGASFGDILPQQLIINAMGQLMQVFSNPSPVALAIAIVTFIGSI
VTLSMELVSTLSDSLRIFLEKVWYRYFHQATEQQAAGASAMPEGFWDEADDKSLHGILGM
IFSAICVSLGLSMAPPKQFPSVMKGVKESLNTANASVTFFRNVVDAIKYMYTYCMGASDE
EMRARIIIEREYPNLKHWCEEVIQLLDPRSRNIVEHDARQASRVFDACIYGAQILQENLD
KSMPGGKVIYDLYTRIVKLRDDLIELGNHPDVRFEAFPVWIVGSAGIGKSYNTTELCKRA
LQSINYRTKESMIYWLALGQKYWNGIRNPPVVARDEAYAVSGQFTEEEISVHLAMCSSCI
LNPPMAALSEKNKRINPLIYYMNANCAFPSIPEARHIGAIYRRRKILAEFDFTEEIKRTY
PNVLDASELPPNARINNNHLRIRVAHDPKNVNTTWSEWMSFDEFSNHFCRKFQEHMEAER
VNFRRRMDAAYALDPDYVPGSNLNYVGDYELPLQTLHERYIYERELAREYLANIENPVNE
IEEDGGFWSNVKRLYENLTTGAADTEMDVPGPSTPSEPPSKRVLRQFLVDHCKFKEDAAA
LLTRGLGVCSEQDVRTFALPPEYQFMKDREFVSAASIYCDTMSCLPNSVCCSYRRIGSAM
NPRSKIGSNWFVLPKNYEDLGGKDAIRSYCYWWIRCYQLRSFKKILKKENYVEWADRMLH
LIGCEPVNNYEVELRRQLWKIRGASESEIIDMLKELDAEARAHNMSDLMAGKELPRITLM
WLLTDLTDNDTSVFCDHCKVFATYMRDLSVLEYVPRYGIIRYPGNFGCMKTIPAECQCED
SIFNNVLFKNAMRILWDHDHVGPEFTEFQDSQTNPFVMQEHNNLRNETRSLLSRIWDWAK
DWWKTTVVPFVGAILTFLYEHWAKILSIILGCVVLYATFTSAKSPTDACMAAAKVSVPVM
AGAVGTWSSPEGSVYQAGERVFKASNAPKPANRESVSDQMHITEQKVINNTCFIICKWQD
GKDTKFLRARCLAIKGRDIIVIKHYLQEFKSRPNPTYMFSYKINNSMANTYIDSSIIDNA
YIYKINNSSAFSNIALIKLPKHVPMFKDISKSIVTQGDHANVGHFCSIVSQQYDEHPVVR
SQVPVTWKQHLVIAGDRHVEQIIMDKCYEYNVRGFGMCGSALVSPGVCCGNGGVIGLHVA
GEKGSGFSEPIFREMFEPVIEKSDPVVSLPNLRSVSESNVQLDHNLILYGCVDEKMSHKE
SGKSKIIPSLVHGEIYPVATEPNPLRPGDPRQPPGSHPLRDGCAKHGLGMVHPFPQEDLE
QVNNDARNVLLNEVKNPLCEMRLLTLQEQVCGSTSIPHCESVNWNSSEGFPLCNRRPAGV
TGKKWLFDMDETAEGYVLKNIDPQLALMLKTNKDLRNRNIVCPPIYIDCLKDYRLPPEKC
CIPGKTRIFSIAPIQTTLEIREYMGLFLSGYKSATVMGQHGIGINPDSYDWTRLANYLHE
VGDNIVTGDYANFGPCVSSQIVYSCIDDIIYWHKINGATEDHCRHLELLLKYSILLPLHL
CDNCVYQSLNGIASGSPITAELNSEVGKKYIKLAFLGICRQLNYKYSLNDFNKHCRVVVY
GDDLILSVSDAFVSWFNLQSISEYLDNYGIRLTDVTKDGTIVKYRPLADSSFLKRSFKPH
PSRSGIYLAPIEPRSYQECTNWCHKQNDEIEATVEVLRASCVLAYGRGPDEYNNHVNKIR
RVCALKGLRFDPLTWAALDKENFG
Download sequence
Identical sequences A7LM73
A7LM73_9VIRU YP_003622540.1.61197 gi|296005647|ref|YP_003622540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]